Dietary total antioxidant capacity is positively associated with muscular strength in cirrhotic outpatients: a cross-sectional study.

BACKGROUND: Cirrhosis is the end-stage of progressive fibrosis, in which oxidative stress and inflammation-related pathways can modulate the cellular and tissue events involved in the pathogenesis of liver fibrosis. Dietary intake of antioxidants has been suggested to protect against oxidative damage and related clinical complications. The present study aimed to investigate the potential association of the dietary total antioxidant capacity (dTAC) with anthropometric, functional and biochemical markers, as well as the severity of the disease, in cirrhotic outpatients. METHODS: Sixty-two outpatients (38 men and 24 women) with a mean (SD) age of 59.1 (9.9) years were evaluated. Dietary TAC was estimated from a food frequency questionnaire. Aetiology and severity of liver cirrhosis, lifestyle characteristics, occurrence of comorbidities and oedema, and anthropometric, functional and biochemical markers were all assessed. RESULTS: Cirrhotic outpatients with higher dTAC also had higher values of the hand-grip strength (P = 0.029) and arm muscle area (P = 0.027). After adjusting by sex, age, smoking and alcohol intake, the addition of 1 mmol day-1 of dTAC contributed to increase 0.552 kg f-1 in hand-grip strength (P < 0.05). The addition of one mmol day-1 of dTAC contributed to an arm muscle area increase 0.565 cm2 (P < 0.05) on average. CONCLUSIONS: The dTAC was positively associated with hand-grip strength and arm muscle area in cirrhotic outpatients. The implications of the present study are important in clinical practice because a diet rich in antioxidants may be an ally in the control of excessive reactive oxygen species production in cirrhotic outpatients with repercussion on muscle mass and strength.

Field Assessments to Control the Lesser Mealworm (Coleoptera: Tenebrionidae) Using Diatomaceous Earth in Poultry Houses.

Control of the lesser mealworm (Alphitobius diaperinus Panzer, 1797 [Coleoptera: Tenebrionidae]) is usually conducted with chemical insecticides, which have limited efficacy as well as environmental and health risks. Diatomaceous earth (DE) is safe and effective in controlling many insects including lesser mealworm. However, little is known of DE efficacy against this pest. Thus, an assessment of DE was conducted for the first time in commercial broiler houses in Brazil, with the aim of developing a strategy for the use of DE in the control of this insect. The efficacy of DE was determinate to a minimum concentration, and the application was directed to the most infested sites. The DE applied to the entire poultry house (280 g/m2) was verified to control the insects. DE was also comparable to chemical treatments, with a reduction of 80% in the insect population. DE controlled the lesser mealworm and is recommended for application at a concentration of 280 g/m2 when applied to the surface of new poultry litter, before the first lot of birds is housed. Thereafter, DE should be reapplied before the housing of each lot of birds, in the same concentration, only in the housing area and under the feeders and near the walls and pillars. In addition to being a control strategy, DE can be an important tool in the management of lesser mealworm insecticide resistance.

Genotypic gain with simultaneous selection of production, nutrition, and culinary traits in cowpea crosses and backcrosses using mixed models.

The aim of this study was to estimate the genotypic gain with simultaneous selection of production, nutrition, and culinary traits in cowpea crosses and backcrosses and to compare different selection indexes. Eleven cowpea populations were evaluated in a randomized complete block design with four replications. Fourteen traits were evaluated, and the following parameters were estimated: genotypic variation coefficient, genotypic determination coefficient, experimental quality indicator and selection reliability, estimated genotypic values ​​- BLUE, genotypic correlation coefficient among traits, and genotypic gain with simultaneous selection of all traits. The genotypic gain was estimated based on tree selection indexes: classical, multiplicative, and the sum of ranks. The genotypic variation coefficient was higher than the environmental variation coefficient for the number of days to start flowering, plant type, the weight of one hundred grains, grain index, and protein concentration. The majority of the traits presented genotypic determination coefficient from medium to high magnitude. The identification of increases in the production components is associated with decreases in protein concentration, and the increase in precocity leads to decreases in protein concentration and cooking time. The index based on the sum of ranks was the best alternative for simultaneous selection of traits in the cowpea segregating populations resulting from the crosses and backcrosses evaluated, with emphasis on the F4BC12, F4C21, and F4C12 populations, which had the highest genotypic gains.

Efficacy of Staphylococcus aureus vaccines for bovine mastitis: a systematic review.

Bovine mastitis is the main cause of economic loss in milk production worldwide and Staphylococcus aureus is the agent most frequently associated with the disease. The aim of this systematic review was to assess the efficacy of vaccines for bovine mastitis caused by S. aureus and suggest the immunotherapeutic protocols that have achieved the best and/or most promising results. An electronic search was made of the PubMed and Web of Science databases in November 2009. Only studies that tested vaccines in vivo in cows were included. The experimental design, methodological quality, type of vaccine and results of the studies were analyzed. Twenty-four papers were selected for this review. In general, bacterin-toxoid vaccines, vaccines of DNA-recombinant protein and recombinant protein alone were investigated in the studies selected. This systematic review suggests that vaccines that employ new technologies (DNA and/or recombinant protein vaccines) and some long-standing bacterins have achieved good results, which supports their use in the prevention and control of bovine mastitis caused by S. aureus. However, methodological differences and in some cases, a lack of more severe scientific criteria (such as double blind protocols) hinder the assessment of the effectiveness of these vaccines.

Eficiência de um novo inseticida comercial para o controle do cascudinho dos aviários (Alphitobius diaperinus) (Panzer) (Coleoptera: Tenebrionidae) / Effectiveness of a new commercial insecticide for the control of the lesser mealworm (Alphitobius diaperinus) (Panzer) (Coleoptera: Tenebrionidae)

O presente estudo foi realizado com o objetivo de avaliar em condições de laboratório e campo, a eficiência de um inseticida Teste (à base de cipermetrina, clorpirifós e citronela), no controle do cascudinho dos aviários (Alphitobius diaperinus). Em laboratório, o produto foi testado sobre insetos adultos, por meio de pulverização sobre os insetos (contato direto) e caminhamento sobre superfície tratada (contato indireto). Posteriormente, foi avaliado em condições de campo, em um aviário de frangos de corte. O produto foi eficiente, sendo comparável ao produto padrão, causando 100% de mortalidade em laboratório e reduzindo a população do aviário em 76%. Assim, o produto constitui-se em uma alternativa para o controle do cascudinho.

The present study was carried out with the objective to evaluate, under laboratory and field conditions, the effectiveness of the insecticide Test (based on cypermethrin, chlorpyrifos and citronellal), for the control of lesser mealworm (Alphitobius diaperinus). In the laboratory, the product was tested on adult insects, by spraying on the insects (direct contact) and by their walking on a treated surface (indirect contact). After this, it was evaluated in field conditions, in a poultry house. The product was effective, being comparable to the standard product, causing 100% of mortality in the laboratory and reducing the population in the poultry house by 76%. Thus, the product presents an alternative for the control of this pest.

Antimycobacterial activity of some Brazilian indigenous medicinal drinks

Tuberculosis (TB) is a very serious problem worldwide and the increasing number of multiple drugs resistant TB cases makes the search for new anti-TB drugs an urgent need. Indigenous knowledge about the use of native plants to treat illnesses has contributed to the discovery of new medicines. In this study, the antimycobacterial activity ofseven medicinal drinks was assessed: Ananas sativus (hydroalcoholic fruit extract), Aristolochia triangularis(aqueous and hydroalcoholic leaf, root and stem extracts), Bromelia antiacantha (hydroalcoholic fruit extract), Stryphnodendron adstringens (hydroalcoholic bark extract), Tabebuia ovellanedae (hydroalcoholic bark extract), Vernonia polyanthes (hydroalcoholic root extract), all used by the Vanuíre indigenous community in the treatment of respiratory diseases. The activity was evaluated by using a time-to-kill assay, in which Mycobacterium tuberculosis H37Rv was cultured on Lowenstein-Jensen medium, after thirty minutes, one, three, six, twelve and twenty-four hours contact of the bacteria with each drink. Within half to one hour contact, the hydroalcoholic drinks of A. triangularis, S. adstringens, T. ovellanedae and V. polyanthes reduced the bacterial growth by 2 orders of magnitude in CFU/mL, and all bacterial growth was absent after three hours contact. In contrast, no mycobactericidal effect was detected in the aqueous extract of A. triangularis or in the hydroalcoholic beverages of A. sativus and B. antiacantha, even aftertwenty-four hours contact.

Platynota rostrana (Walker) (Tortricidae) and Phidotricha erigens Raganot (Pyralidae): artificial diet effects on biological cycle

The lepidopterans Platynota rostrana (Walker) (Tortricidae) and Phidotricha erigens Raganot (Pyralidae) have been found frequently in citrus groves in São Paulo State in recent years. Since in Brazil, the fertility cycle of these two species is largely unknown, as are details of the damage wrought by them in crops, this research studied these aspects of the two species, which were kept under laboratory conditions (temperature 25 ± 2 °C, 70 ± 10 percent RH, 14 h photophase) and on an artificial diet. The duration of the biological cycle (egg-adult) for P. rostrana was 38.3 days and total viability was 44.0 percent; for P. erigens these values were 32.5 days and 63.6 percent, respectively. Both species showed five larval instars. Females of P. rostrana laid an average of 308 eggs, whereas those of P. erigens laid an average of 106 eggs. In both species, female pupae were heavier than males. Male and female longevity for both species was nearly 10 days. Based on the data obtained, the artificial diet produced better results in P. rostrana than in P. erigens. If these species, which have the potential to reach pest status in the citrus groves of São Paulo State, could be reared on an artificial diet, research on their control by alternative methods would be easier.

Os lepidópteros Platynota rostrana (Walker) (Tortricidae) e Phidotricha erigens Raganot (Pyralidae) têm sido constatados com freqüência nos pomares cítricos do Estado de São Paulo, nos últimos anos. O objetivo deste trabalho foi estudar a biologia das duas espécies, em condições de laboratório (temperatura 25 ± 2 °C, UR. 70 ± 10 por cento e fotofase de 14 h) em dieta artificial, elaborar uma tabela de vida de fertilidade e descrever os danos causados no campo, devido ao desconhecimento destes aspectos biológicos dos referidos insetos no Brasil. A duração do ciclo biológico (ovo-adulto) de P. rostrana foi de 38,3 dias e a viabilidade total de 44,0 por cento, enquanto para P. erigens foi de 32,5 dias e 63,6 por cento, respectivamente. Ambas as espécies apresentaram cinco ínstares e as pupas de fêmeas foram mais pesadas do que as de machos. As fêmeas de P. rostrana colocaram, em média, 308 ovos e as de P. erigens 106 ovos. A longevidade de machos e fêmeas das duas espécies foi próxima de 10 dias. Pela tabela de vida de fertilidade concluiu-se que P. rostrana tem melhor desempenho em dieta artificial que P. erigens. É possível criar estas espécies em dieta artificial, facilitando o desenvolvimento de pesquisas relacionadas ao seu controle por métodos alternativos, caso elas assumam o status de pragas nos pomares de São Paulo.

Platynota rostrana (Walker) (Tortricidae) AND Phidotricha erigens Raganot (Pyralidae): artificial diet effects on biological cycle.

The lepidopterans Platynota rostrana (Walker) (Tortricidae) and Phidotricha erigens Raganot (Pyralidae) have been found frequently in citrus groves in São Paulo State in recent years. Since in Brazil, the fertility cycle of these two species is largely unknown, as are details of the damage wrought by them in crops, this research studied these aspects of the two species, which were kept under laboratory conditions (temperature 25 +/- 2 degrees C, 70 +/- 10% RH, 14 h photophase) and on an artificial diet. The duration of the biological cycle (egg-adult) for P. rostrana was 38.3 days and total viability was 44.0%; for P. erigens these values were 32.5 days and 63.6%, respectively. Both species showed five larval instars. Females of P. rostrana laid an average of 308 eggs, whereas those of P. erigens laid an average of 106 eggs. In both species, female pupae were heavier than males. Male and female longevity for both species was nearly 10 days. Based on the data obtained, the artificial diet produced better results in P. rostrana than in P. erigens. If these species, which have the potential to reach pest status in the citrus groves of São Paulo State, could be reared on an artificial diet, research on their control by alternative methods would be easier.

Structural and functional characterization of basic PLA2 isolated from Crotalus durissus terrificus venom.

The venom of Crotalus durissus terrificus was fractionated by reverse-phase HPLC to obtain crotapotins (F5 and F7) and PLA2 (F15, F16, and F17) of high purity. The phospholipases A2 (PLA2S) and crotapotins showed antimicrobial activity against Xanthomonas axonopodis pv. passiflorae, although the unseparated crotoxin did not. The F17 of the PLA2 also revealed significant anticoagulant activity, althrough for this to occur the presence of Glu 53 and Trp 61 is important. The F17 of the PLA2 showed allosteric behavior in the presence of a synthetic substrate. The amino acid sequence of this PLA2 isoform, determined by automatic sequencing, was HLLQFNKMLKFETRK NAVPFYAFGCYCGWGGQRRPKDATDRCCFVHDCCYEKVTKCNTKWDFYRYSLKSGY ITCGKGTWCKEQICECDRVAAECLRRSLSTYKNEYMFYPDSRCREPSETC. Analysis showed that the sequence of this PLA2 isoform differed slightly from the amino acid sequence of the basic crotoxin subunit reported in the literature. The homology with other crotalid PLA2 cited in the literature varied from 60% to 90%. The pL was estimated to be 8.15, and the calculated molecular weight was 14664.14 as determined by Tricine SDS-PAGE, two-dimensional electrophoresis, and MALDI-TOFF. These results also suggested that the enzymatic activity plays an important role in the bactericidal effect of the F17 PLA2 as well as that of anticoagulation, although other regions of the molecule may also be involved in this biological activity.

On the high affinity of 8-cyclohexylcaffeine for the presynaptic inhibitory adenosine receptor present in rat motor nerve terminals.

Rat neuromuscular junction was used to study the characteristics of presynaptic A1 adenosine receptors. We investigated the ability of the 8-substituted caffeine, 8-cyclohexylcaffeine (CHC), as well as of 1,3,8-substituted xanthines, 1,3-dipropyl-8-p-sulfophenylxanthine (DPSPX) and 8-p-sulfophenyl-1-isoamyl-3-isobutylxanthine (SPIIBX) to antagonize the inhibitory effect of 2-chloroadenosine on the amplitude of nerve-evoked twitches of the rat phrenic-hemidiaphragm, and we compared the affinity of these xanthines with that of 1,3-dipropyl-8-cyclopenthylxanthine (DPCPX). CHC, DPSPX and SPIIBX in a near parallel manner shifted to the right the log concentration-response curve for the inhibitory effect of 2-chloroadenosine on nerve-evoked twitch amplitude. Linear Schild plots with slopes near to unity were obtained for all these xanthines. The order of potency of the xanthines was DPCPX (Ki = 0.53 nM) > DPSPX (38 nM) = CHC (41 nM) > SPIIBX (404 nM). The affinities of DPSPX and SPIIBX for the A1 receptor at the rat neuromuscular junction are in agreement with the affinities described for A1 receptors at brain membranes. The now reported affinity of CHC for the presynaptic A1 receptor is 683 times higher than that obtained in binding studies in rat brain membranes, and is only 49 times higher than that obtained in functional assays (adenylate cyclase activity) in non-neuronal preparations (rat fat cells).